PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn166841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 104aa    MW: 12113.8 Da    PI: 11.3783
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn166841genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.79.5e-128411448
                     HHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 14 davkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +a++++++ +W++Ia +++ gRt++++k++w+++l
       Achn166841  8 EAHRLHPKARWSLIAGRLP-GRTDNEVKNYWNSHL 41
                     79*****************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.07145IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-14841IPR009057Homeodomain-like
PfamPF002497.8E-10841IPR001005SANT/Myb domain
CDDcd001676.04E-9841No hitNo description
SuperFamilySSF466893.74E-10951IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MVQARRPEAH RLHPKARWSL IAGRLPGRTD NEVKNYWNSH LSKKLKNKGI HHPHKPDRLR  60
QRSIDHQPVR SHDTRVNTSQ ILPDLNLNLS LSNPVEEKLY QLQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009387271.11e-17PREDICTED: myb-related protein 308-like
TrEMBLD0VYJ64e-20D0VYJ6_DIOKA; Putative MYB transcription factor
STRINGGSMUA_AchrUn_randomP16400_0013e-17(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1741834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.16e-17myb domain protein 4